PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00010958-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family FAR1
Protein Properties Length: 501aa    MW: 57060.5 Da    PI: 8.2945
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00010958-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR190.32.6e-2865152191
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            +fY+eYAk++GF++++++s++sk+++e+++++f Cs++g + e+++     +r+ ++++t+Cka+++vkk++dgkw+++++++eHnHe
  SMil_00010958-RA_Salv  65 SFYQEYAKSMGFTTSIKNSRRSKKTKEFIDAKFACSRYGVTPESESG---VSRRPSVKKTDCKASMHVKKKRDGKWYIHEFVKEHNHE 149
                            5****************************************999887...77778899****************************** PP

                   FAR1  89 lap 91 
                            l p
  SMil_00010958-RA_Salv 150 LLP 152
                            975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031019.8E-2665152IPR004330FAR1 DNA binding domain
PROSITE profilePS5096610.027228264IPR007527Zinc finger, SWIM-type
PfamPF044345.3E-8228261IPR007527Zinc finger, SWIM-type
SMARTSM005751.2E-8239266IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MVDFEDNVGG GEQSLALNVV DIVDVSKSRE GQVSSSSRRD VVGIEGDSFE PHDGIEFDSH  60
EAAYSFYQEY AKSMGFTTSI KNSRRSKKTK EFIDAKFACS RYGVTPESES GVSRRPSVKK  120
TDCKASMHVK KKRDGKWYIH EFVKEHNHEL LPALAYHFRI HRNVKLAEKS NIDILYAVSE  180
RTRKMYVEMS RQAIIEVLGV VGCHPKKEKE YGGSTTFRVD DCEKNENFVV TWNEGKSEVS  240
CSCLMFEYKG FLCRHAMIVL QICGLSSIPS QYILKRWMKD AKGKQLLVEG TERYQNRIQR  300
YNDLCKRSYW TGRRKVPFEW RRITTLSCRA LVEALKSCVH INNENPVECS SNTAGLRFTE  360
EEDLLLPPAK TIKKKNANKK RKTQPEPEAV AIDTQDSLHQ MEHLSSEEIP VNGYYGSQQH  420
VHGLLNLMEP PNDGFYVGHQ TMQGLGQLHS LASSHDSFYG AHQQSMPALG HLDFRQPTFT  480
YGMQDDQSVR PAQLHGTARH A
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085456.11e-149PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1
RefseqXP_011085457.11e-149PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1
SwissprotQ9SWG33e-92FAR1_ARATH; Protein FAR-RED IMPAIRED RESPONSE 1
TrEMBLA0A0B0NR120.0A0A0B0NR12_G
STRINGSolyc08g060840.1.11e-117(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49621103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.14e-87FAR1 family protein